Software Index
 

Paul Joseph Davis

home home  
Address
Address:
State/Province:
ZIP Code:
City:
Country:
Contact information
Phone:
Fax:
Products
Records 1-2 of 2
Product Title  /  Popularity Revised License Rating Size
nebgb
nebgb is a Genbank file parser library.

Usage:

>>> import nebgb
>>> rec = nebgb.parse_file("./test/data/simple-1.gb").next()
>>> rec.locus["name"]
'NP_034640'
>>> rec.locus["length"]
182
>>> rec.keywords["source"]["name"]
'house mouse'
>>> rec.features[1]["properties"]["product"]
'interferon beta, fibroblast'
>>> for seq in rec.seqiter:
... print seq
mnnrwilhaafllcfsttalsinykqlqlqertnirkcqelleqlngkinltyradfkip
memtekmqksytafaiqemlqnvflvfrnnfsstgwnetivvrlldelhqqtvflktvle
ekqeerltwemsstalhlksyywrvqrylklmkynsyawmvvraeifrnfliirrltrnf
...
August 24th 2011 Freeware    297k
nebseq
nebseq is a Python module for basic biological sequence manipulations.

Import as usual

>>> import nebseq

Reverse complements

The only note here is that revcomp does not check the input sequence to see if it looks like DNA or RNA.

>>> nebseq.revcomp('ACGT')
'ACGT'
...
July 25th 2011 Freeware    10k

New Software
Popular Software
Latest Reviews