Software Index
Linux Software Utilities  

nebgb

download download home home   report broken
important software information
company name:
Paul Joseph Davis
license: Freeware
minimum requirements:
functional limitations:
nebgb description


nebgb is a Genbank file parser library.

Usage:

>>> import nebgb
>>> rec = nebgb.parse_file("./test/data/simple-1.gb").next()
>>> rec.locus["name"]
'NP_034640'
>>> rec.locus["length"]
182
>>> rec.keywords["source"]["name"]
'house mouse'
>>> rec.features[1]["properties"]["product"]
'interferon beta, fibroblast'
>>> for seq in rec.seqiter:
... print seq
mnnrwilhaafllcfsttalsinykqlqlqertnirkcqelleqlngkinltyradfkip
memtekmqksytafaiqemlqnvflvfrnnfsstgwnetivvrlldelhqqtvflktvle
ekqeerltwemsstalhlksyywrvqrylklmkynsyawmvvraeifrnfliirrltrnf
qn

Alternatively you can use nebgb.parse() to parse a string or iterator that yields lines of a Genbank file.. .



Similar software
nebseq (Popularity: ) : nebseq is a Python module for basic biological sequence manipulations.

Import as usual

>>> import nebseq

Reverse complements

The only note here is that revcomp does not check the input sequence to see if it looks like DNA or RNA.

>>> nebseq.revcomp('ACGT')
'ACGT'
...

Net::Printer (Popularity: ) : Net::Printer is a Perl module for directly printing to a print server/printer without having to create a pipe to either lpr or lp. This essentially mimics what the BSD LPR program does by connecting directly to the line printer printer ...
User reviews

Write a review:
1 2 3 4 5 6 7 8 9 10
1=poor 10=excellent
Write review*
Your name*
Email*
  (Comments are moderated, and will not appear on this site until the editor has approved them)
 
AD


Rate me
supported os's
stats
downloads 3
version 0.1.1
size in Kb 297
popularity   
699/1272475
user rating 0/10
our rating 0 Stars
share info
Recommend nebgb
Report spyware
New Software
Popular Software
Latest Reviews